PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.19NMA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB
Protein Properties Length: 523aa    MW: 58076.7 Da    PI: 4.8386
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.19NMAgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.4e-174087148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lvd+vk+ G g+W+++ r+ g+ R++k+c++rw ++l
      Araip.19NMA 40 KGPWTSAEDAILVDYVKKNGEGNWNAVQRHSGLARCGKSCRLRWANHL 87
                     79******************************************9986 PP

2Myb_DNA-binding51.91.8e-1693136146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ +++++++++G++ W++ a++++ gRt++++k++w++
      Araip.19NMA  93 KGAFTEEEERRIIELHAKMGNK-WARMAAELP-GRTDNEIKNYWNT 136
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.5493587IPR017930Myb domain
SuperFamilySSF466892.47E-2938134IPR009057Homeodomain-like
SMARTSM007175.5E-133989IPR001005SANT/Myb domain
PfamPF002492.6E-144087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-234194IPR009057Homeodomain-like
CDDcd001671.81E-104287No hitNo description
PROSITE profilePS5129425.41588142IPR017930Myb domain
SMARTSM007175.1E-1692140IPR001005SANT/Myb domain
PfamPF002492.0E-1593136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-2595140IPR009057Homeodomain-like
CDDcd001671.58E-6107136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MSTMTNKCDG RKVSKVRRSS SSVEEDSGES NIGGEGHLKK GPWTSAEDAI LVDYVKKNGE  60
GNWNAVQRHS GLARCGKSCR LRWANHLRPD LRKGAFTEEE ERRIIELHAK MGNKWARMAA  120
ELPGRTDNEI KNYWNTRIKR MQRAGLPIYP PDVCLRVMHG NQESVNVGTL RDEANQHDDL  180
SQTDTLDIPE LDFKLVKVCP GLSYGPSICD IPESSMVEMS SDSSHGYNHM FPVMPPSKRL  240
RESDMQYGYL DSCISDTVPI FEQYGDYTCD KISDHTQLSS PCDPILNTSD QFHGDDTYGS  300
HATLNGNTSS SVPLPGAMKL ELPSLQYFET QHGIWGTPAS PLPSLESVDT MIQSPPAKPS  360
PSDPVSPERS GLLEAIIYQP KQLQVANNNS LQATPNDCVR KEVKISTMKS KPECDEQGGP  420
YFPLDQSAAS VATNYTSISM CLVDAPQSVE TIQDHNIKQE LGTQYPAYVS GKKENWNQID  480
FTRPDALLDL GWYGSGIDCD DYDGDRFLFK DAFSPFLGQD PDG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31381405106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016197062.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_016197063.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLK7LXA10.0K7LXA1_SOYBN; Uncharacterized protein
STRINGGLYMA13G04031.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.37e-92myb domain protein 33